CDS

Accession Number TCMCG068C27952
gbkey CDS
Protein Id KAG5595823.1
Location complement(join(32922885..32923033,32923085..32923130))
Organism Solanum commersonii
locus_tag H5410_037055

Protein

Length 64aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA655804, BioSample:SAMN15755581
db_source JACXVP010000007.1
Definition hypothetical protein H5410_037055 [Solanum commersonii]
Locus_tag H5410_037055

EGGNOG-MAPPER Annotation

COG_category C
Description PsaA and PsaB bind P700, the primary electron donor of photosystem I (PSI), as well as the electron acceptors A0, A1 and FX. PSI is a plastocyanin-ferredoxin oxidoreductase, converting photonic excitation into a charge separation, which transfers an electron from the donor P700 chlorophyll pair to the spectroscopically characterized acceptors A0, A1, FX, FA and FB in turn. Oxidized P700 is reduced on the lumenal side of the thylakoid membrane by plastocyanin
KEGG_TC -
KEGG_Module M00163        [VIEW IN KEGG]
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00002        [VIEW IN KEGG]
ko00194        [VIEW IN KEGG]
KEGG_ko ko:K02690        [VIEW IN KEGG]
EC -
KEGG_Pathway ko00195        [VIEW IN KEGG]
ko01100        [VIEW IN KEGG]
map00195        [VIEW IN KEGG]
map01100        [VIEW IN KEGG]
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0009507        [VIEW IN EMBL-EBI]
GO:0009534        [VIEW IN EMBL-EBI]
GO:0009535        [VIEW IN EMBL-EBI]
GO:0009536        [VIEW IN EMBL-EBI]
GO:0009579        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0016168        [VIEW IN EMBL-EBI]
GO:0031976        [VIEW IN EMBL-EBI]
GO:0031984        [VIEW IN EMBL-EBI]
GO:0034357        [VIEW IN EMBL-EBI]
GO:0042651        [VIEW IN EMBL-EBI]
GO:0043167        [VIEW IN EMBL-EBI]
GO:0043168        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044434        [VIEW IN EMBL-EBI]
GO:0044435        [VIEW IN EMBL-EBI]
GO:0044436        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046906        [VIEW IN EMBL-EBI]
GO:0048037        [VIEW IN EMBL-EBI]
GO:0055035        [VIEW IN EMBL-EBI]
GO:0097159        [VIEW IN EMBL-EBI]
GO:1901363        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGACTGGCCCAGCATTCAATGCGGGTCAAAGAATCTGGTTGTCGGGTCCTGGAGACTTTTTGGTTCATCATGCTATTGCACTTGGTTTAATTACAACTACATTGATCTTAGTAAAAGGTGCTTTAGATGCACGTGGTTCCAAGTTAATGCTAGTAAAAAAGGATTTCGGTTATAGTTTTCCGTGCAATAACTAG
Protein:  
MTGPAFNAGQRIWLSGPGDFLVHHAIALGLITTTLILVKGALDARGSKLMLVKKDFGYSFPCNN